PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_1DS_F22A3DB6A.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family MIKC_MADS
Protein Properties Length: 269aa    MW: 30418.3 Da    PI: 9.6273
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_1DS_F22A3DB6A.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF97.45.9e-314595151
                           S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
                 SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                           krien++nrqvtf+kRrng+lKKA+ELSvLCdaeva+i+fs +g+lyeys+
  Traes_1DS_F22A3DB6A.1 45 KRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSGRGRLYEYSN 95
                           79***********************************************95 PP

2K-box103.82.3e-341122093100
                  K-box   3 kssgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqee 90 
                            +ss   ++e +a+++qqe+akLk++i +Lq+++R l+G+ + ++s+++L+qLe +L+k+l kiR++Knell+++ie++q++e elq++
  Traes_1DS_F22A3DB6A.1 112 TSSAGTVAEINAQHYQQESAKLKQQITTLQNSNRTLIGDTMATMSHRDLKQLEGRLDKGLGKIRARKNELLCAEIEYMQRREMELQNN 199
                            4455559999****************************************************************************** PP

                  K-box  91 nkaLrkklee 100
                            n  Lr+k++e
  Traes_1DS_F22A3DB6A.1 200 NFFLREKVAE 209
                            *******986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004327.1E-413796IPR002100Transcription factor, MADS-box
PROSITE profilePS5006633.5433797IPR002100Transcription factor, MADS-box
CDDcd002657.55E-4438114No hitNo description
SuperFamilySSF554552.22E-3238109IPR002100Transcription factor, MADS-box
PROSITE patternPS0035003993IPR002100Transcription factor, MADS-box
PRINTSPR004044.4E-323959IPR002100Transcription factor, MADS-box
PfamPF003192.3E-264693IPR002100Transcription factor, MADS-box
PRINTSPR004044.4E-325974IPR002100Transcription factor, MADS-box
PRINTSPR004044.4E-327495IPR002100Transcription factor, MADS-box
PfamPF014861.7E-25122207IPR002487Transcription factor, K-box
PROSITE profilePS5129713.598123213IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 269 aa     Download sequence    Send to blast
MQILNEQLAA PSTGLMVKES ASPGSGSGSA GGAAEKMGRG RIEIKRIENT TNRQVTFCKR  60
RNGLLKKAYE LSVLCDAEVA LIVFSGRGRL YEYSNNSVKA TIERYKKATS DTSSAGTVAE  120
INAQHYQQES AKLKQQITTL QNSNRTLIGD TMATMSHRDL KQLEGRLDKG LGKIRARKNE  180
LLCAEIEYMQ RREMELQNNN FFLREKVAET ERGQQQTLNM MGAASTSNEY EQNMIHCDPR  240
TFLQFNFMQQ QPQYYSQQED RKSFNSVGR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_S9e-2037105169Myocyte-specific enhancer factor 2B
1tqe_R9e-2037105169Myocyte-specific enhancer factor 2B
1tqe_Q9e-2037105169Myocyte-specific enhancer factor 2B
1tqe_P9e-2037105169Myocyte-specific enhancer factor 2B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0089120.0BT008912.1 Triticum aestivum clone wpa1c.pk001.p9:fis, full insert mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001288321.11e-161MADS-box transcription factor 58-like
SwissprotQ2V0P11e-145MAD58_ORYSJ; MADS-box transcription factor 58
TrEMBLW5ANM40.0W5ANM4_WHEAT; Uncharacterized protein
STRINGMLOC_57700.10.0(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP64937144
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G18960.12e-96MIKC_MADS family protein
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]